FBXO28 anticorps (Middle Region)
-
- Antigène Voir toutes FBXO28 Anticorps
- FBXO28 (F-Box Protein 28 (FBXO28))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FBXO28 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FBXO28 antibody was raised against the middle region of FBXO28
- Purification
- Affinity purified
- Immunogène
- FBXO28 antibody was raised using the middle region of FBXO28 corresponding to a region with amino acids ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK
- Top Product
- Discover our top product FBXO28 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FBXO28 Blocking Peptide, catalog no. 33R-2539, is also available for use as a blocking control in assays to test for specificity of this FBXO28 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO28 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FBXO28 (F-Box Protein 28 (FBXO28))
- Autre désignation
- FBXO28 (FBXO28 Produits)
- Synonymes
- anticorps fd49h06, anticorps wu:fd49h06, anticorps FBXO28, anticorps CENP-30, anticorps Fbx28, anticorps 4833428J17Rik, anticorps 5730505P19Rik, anticorps D1Ertd578e, anticorps mKIAA0483, anticorps F-box protein 28, anticorps F-box protein 28 L homeolog, anticorps fbxo28, anticorps fbxo28.L, anticorps FBXO28, anticorps Fbxo28
- Sujet
- Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
- Poids moléculaire
- 41 kDa (MW of target protein)
-