TRAPPC6B anticorps (Middle Region)

N° du produit ABIN631728

Détail du produit anti-TRAPPC6B anticorps

Antigène: TRAPPC6B (Trafficking Protein Particle Complex 6B (TRAPPC6B))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRAPPC6B est non-conjugé

Application: Western Blotting (WB)

Specificité: TRAPPC6 B antibody was raised against the middle region of TRAPPC6

Purification: Affinity purified

Immunogène: TRAPPC6 B antibody was raised using the middle region of TRAPPC6 corresponding to a region with amino acids TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRAPPC6B Blocking Peptide, catalog no. 33R-9336, is also available for use as a blocking control in assays to test for specificity of this TRAPPC6B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRAPPC6B

Antigène: TRAPPC6B (Trafficking Protein Particle Complex 6B (TRAPPC6B))

Autre désignation: TRAPPC6B (TRAPPC6B Produits)

Synonymes: anticorps zgc:103464, anticorps TPC6, anticorps 5830498C14Rik, anticorps C79212, anticorps RGD1309325, anticorps trafficking protein particle complex 6b, anticorps Trafficking protein particle complex subunit 6B, anticorps trafficking protein particle complex subunit 6B, anticorps trafficking protein particle complex subunit 6b, anticorps trafficking protein particle complex 6B, anticorps trafficking protein particle complex 6B L homeolog, anticorps LOC733029, anticorps cgd3_2700, anticorps NCU06212, anticorps ATEG_05652, anticorps LOC5563708, anticorps CC1G_04333, anticorps CpipJ_CPIJ005932, anticorps PTRG_01279, anticorps TTHERM_00657360, anticorps PITG_00953, anticorps Tsp_08307, anticorps trappc6b, anticorps trappc6b.L, anticorps TRAPPC6B, anticorps Trappc6b

Sujet: TRAPPC6B is a component of TRAPP complexes, which are tethering complexes involved in vesicle transport.

Poids moléculaire: 15 kDa (MW of target protein)