TRAPPC6B anticorps (Middle Region)

N° du produit ABIN631728

Détail du produit anti-TRAPPC6B anticorps

Antigène: TRAPPC6B (Trafficking Protein Particle Complex 6B (TRAPPC6B))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRAPPC6B est non-conjugé

Application: Western Blotting (WB)

Specificité: TRAPPC6 B antibody was raised against the middle region of TRAPPC6

Purification: Affinity purified

Immunogène: TRAPPC6 B antibody was raised using the middle region of TRAPPC6 corresponding to a region with amino acids TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRAPPC6B Blocking Peptide, catalog no. 33R-9336, is also available for use as a blocking control in assays to test for specificity of this TRAPPC6B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRAPPC6B

Antigène: TRAPPC6B (Trafficking Protein Particle Complex 6B (TRAPPC6B))

Autre désignation: TRAPPC6B (TRAPPC6B Produits)

Sujet: TRAPPC6B is a component of TRAPP complexes, which are tethering complexes involved in vesicle transport.

Poids moléculaire: 15 kDa (MW of target protein)