RAB3IL1 anticorps
-
- Antigène Voir toutes RAB3IL1 Anticorps
- RAB3IL1 (RAB3A Interacting Protein (Rabin3)-Like 1 (RAB3IL1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RAB3IL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- RAB3 IL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRH
- Top Product
- Discover our top product RAB3IL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RAB3IL1 Blocking Peptide, catalog no. 33R-1472, is also available for use as a blocking control in assays to test for specificity of this RAB3IL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 L1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RAB3IL1 (RAB3A Interacting Protein (Rabin3)-Like 1 (RAB3IL1))
- Autre désignation
- RAB3IL1 (RAB3IL1 Produits)
- Synonymes
- anticorps GRAB, anticorps 1200014K04Rik, anticorps AI115013, anticorps C76746, anticorps Rab3ail1, anticorps Grab, anticorps RAB3A interacting protein like 1, anticorps RAB3A interacting protein (rabin3)-like 1, anticorps RAB3A interacting protein-like 1, anticorps RAB3IL1, anticorps Rab3il1
- Sujet
- RAB3IL1 is a guanine nucleotide exchange factor (GEF) for Rab3A, a GTPase that regulates synaptic vesicle exocytosis.
- Poids moléculaire
- 43 kDa (MW of target protein)
-