TSR1 anticorps
-
- Antigène Voir toutes TSR1 Anticorps
- TSR1 (TSR1, 20S rRNA Accumulation, Homolog (TSR1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TSR1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- TSR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRV
- Top Product
- Discover our top product TSR1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TSR1 Blocking Peptide, catalog no. 33R-5698, is also available for use as a blocking control in assays to test for specificity of this TSR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TSR1 (TSR1, 20S rRNA Accumulation, Homolog (TSR1))
- Autre désignation
- TSR1 (TSR1 Produits)
- Synonymes
- anticorps AU040765, anticorps AW550801, anticorps mKIAA1401, anticorps TSR1 20S rRNA accumulation, anticorps TSR1, ribosome maturation factor L homeolog, anticorps TSR1, ribosome maturation factor, anticorps Tsr1, anticorps tsr1.L, anticorps TSR1
- Sujet
- TSR1 belongs to the BMS1/TSR1 family and TSR1 subfamily. TSR1 is required during maturation of the 40S ribosomal subunit in the nucleolus.
- Poids moléculaire
- 92 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-