SAR1B anticorps
-
- Antigène Voir toutes SAR1B Anticorps
- SAR1B (SAR1 Homolog B (SAR1B))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SAR1B est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SAR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ
- Top Product
- Discover our top product SAR1B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SAR1B Blocking Peptide, catalog no. 33R-8038, is also available for use as a blocking control in assays to test for specificity of this SAR1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SAR1B (SAR1 Homolog B (SAR1B))
- Autre désignation
- SAR1B (SAR1B Produits)
- Synonymes
- anticorps SAR1, anticorps SAR1B, anticorps SARA2, anticorps 2310075M17Rik, anticorps 2900019I22Rik, anticorps CMRD, anticorps Sara1b, anticorps Sara2, anticorps Sarb, anticorps cmrd, anticorps gtbpb, anticorps sar1a, anticorps sara2, anticorps SARA1B, anticorps ANDD, anticorps GTBPB, anticorps zgc:73204, anticorps secretion associated Ras related GTPase 1B, anticorps hypothetical protein, anticorps SAR1 homolog B (S. cerevisiae), anticorps secretion associated, Ras related GTPase 1B L homeolog, anticorps secretion associated, Ras related GTPase 1B, anticorps SAR1B, anticorps Sar1B, anticorps sar1b, anticorps Sar1b, anticorps sar1b.L
- Sujet
- SAR1B is involved in transport from the endoplasmic reticulum to the Golgi apparatus. SAR1B is activated by the guanine nucleotide exchange factor PREB. SAR1B is involved in the selection of the protein cargo and the assembly of the COPII coat complex.
- Poids moléculaire
- 22 kDa (MW of target protein)
- Pathways
- Lipid Metabolism
-