RCC2 anticorps (Middle Region)
-
- Antigène Voir toutes RCC2 Anticorps
- RCC2 (Regulator of Chromosome Condensation 2 (RCC2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RCC2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RCC2 antibody was raised against the middle region of RCC2
- Purification
- Affinity purified
- Immunogène
- RCC2 antibody was raised using the middle region of RCC2 corresponding to a region with amino acids RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT
- Top Product
- Discover our top product RCC2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RCC2 Blocking Peptide, catalog no. 33R-7978, is also available for use as a blocking control in assays to test for specificity of this RCC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RCC2 (Regulator of Chromosome Condensation 2 (RCC2))
- Autre désignation
- RCC2 (RCC2 Produits)
- Synonymes
- anticorps RCC2, anticorps TD-60, anticorps 2610510H01Rik, anticorps 2610529N02Rik, anticorps AA536646, anticorps AA675016, anticorps Td60, anticorps mKIAA1470, anticorps td-60, anticorps wu:fb36a03, anticorps zgc:77115, anticorps RGD1309986, anticorps regulator of chromosome condensation 2, anticorps regulator of chromosome condensation 2 L homeolog, anticorps RCC2, anticorps Rcc2, anticorps rcc2, anticorps rcc2.L
- Sujet
- RCC2 is required for completion of mitosis and cytokinesis. RCC2 may function as a guanine nucleotide exchange factor for the small GTPase RAC1.
- Poids moléculaire
- 56 kDa (MW of target protein)
-