UPP1 anticorps (N-Term)

N° du produit ABIN631743

Détail du produit anti-UPP1 anticorps

Antigène: UPP1 (Uridine Phosphorylase 1 (UPP1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UPP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: UPP1 antibody was raised against the N terminal of UPP1

Purification: Affinity purified

Immunogène: UPP1 antibody was raised using the N terminal of UPP1 corresponding to a region with amino acids AATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UPP1 Blocking Peptide, catalog no. 33R-1052, is also available for use as a blocking control in assays to test for specificity of this UPP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UPP1

Antigène: UPP1 (Uridine Phosphorylase 1 (UPP1))

Autre désignation: UPP1 (UPP1 Produits)

Synonymes: anticorps upp1, anticorps UDRPASE, anticorps UP, anticorps UPASE, anticorps UPP, anticorps im:6911242, anticorps zgc:110755, anticorps AI325217, anticorps UPase, anticorps UdRPase, anticorps Up, anticorps Upp, anticorps uridine phosphorylase 1, anticorps uridine phosphorylase, anticorps upp1, anticorps NP_RS08675, anticorps Tsp_02326, anticorps UPP1, anticorps Upp1

Sujet: UPP1 catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process