IARS anticorps (Middle Region)
-
- Antigène Voir toutes IARS Anticorps
- IARS (Isoleucyl-tRNA Synthetase (IARS))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IARS est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- IARS antibody was raised against the middle region of IARS
- Purification
- Affinity purified
- Immunogène
- IARS antibody was raised using the middle region of IARS corresponding to a region with amino acids YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD
- Top Product
- Discover our top product IARS Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IARS Blocking Peptide, catalog no. 33R-10078, is also available for use as a blocking control in assays to test for specificity of this IARS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IARS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IARS (Isoleucyl-tRNA Synthetase (IARS))
- Autre désignation
- IARS (IARS Produits)
- Synonymes
- anticorps fi46h05, anticorps zgc:63790, anticorps wu:fi46h05, anticorps K19E20.18, anticorps K19E20_18, anticorps ovule abortion 2, anticorps ECK0027, anticorps ilvS, anticorps JW0024, anticorps An08g06770, anticorps AO090012000505, anticorps 2510016L12Rik, anticorps AI327140, anticorps AU044614, anticorps E430001P04Rik, anticorps ILRS, anticorps Iarsl, anticorps IARS1, anticorps ILERS, anticorps IRS, anticorps PRO0785, anticorps isoleucyl-tRNA synthetase, anticorps tRNA synthetase class I (I, L, M and V) family protein, anticorps isoleucine--tRNA ligase, anticorps isoleucyl-tRNA synthetase, cytoplasmic, anticorps isoleucine-tRNA synthetase, anticorps iars, anticorps IARS, anticorps OVA2, anticorps ileS, anticorps MBAR_RS19160, anticorps Rmag_0340, anticorps ANI_1_964074, anticorps CHLREDRAFT_106327, anticorps EDI_049880, anticorps OE_RS08520, anticorps AOR_1_1912194, anticorps Iars
- Sujet
- Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Two alternatively spliced variants have been isolated that represent alternate 5' UTRs.
- Poids moléculaire
- 144 kDa (MW of target protein)
-