GPN2 anticorps (Middle Region)

N° du produit ABIN631748

Détail du produit anti-GPN2 anticorps

Antigène: GPN2 (GPN-Loop GTPase 2 (GPN2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPN2 est non-conjugé

Application: Western Blotting (WB)

Specificité: GPN2 antibody was raised against the middle region of GPN2

Purification: Affinity purified

Immunogène: GPN2 antibody was raised using the middle region of GPN2 corresponding to a region with amino acids VLQAVDKANGYCFRAQEQRSLEAMMSAAMGADFHFSSTLGIQEKYLAPSN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPN2 Blocking Peptide, catalog no. 33R-9680, is also available for use as a blocking control in assays to test for specificity of this GPN2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GPN2

Antigène: GPN2 (GPN-Loop GTPase 2 (GPN2))

Autre désignation: GPN2 (GPN2 Produits)

Synonymes: anticorps ATPBD1B, anticorps Atpbd1b, anticorps RGD1311749, anticorps atpbd1b, anticorps zgc:92877, anticorps AI838661, anticorps R74630, anticorps RP23-137L22.10, anticorps GPN-loop GTPase 2, anticorps GPN-loop GTPase 2 S homeolog, anticorps G-patch domain containing 3, anticorps GPN2, anticorps Gpn2, anticorps gpn2.S, anticorps gpn2, anticorps GPATCH3

Sujet: The function of GPN protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 34 kDa (MW of target protein)