FASTKD2 anticorps (Middle Region)
-
- Antigène Voir toutes FASTKD2 Anticorps
- FASTKD2 (FAST Kinase Domains 2 (FASTKD2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FASTKD2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FASTKD2 antibody was raised against the middle region of FASTKD2
- Purification
- Affinity purified
- Immunogène
- FASTKD2 antibody was raised using the middle region of FASTKD2 corresponding to a region with amino acids DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR
- Top Product
- Discover our top product FASTKD2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FASTKD2 Blocking Peptide, catalog no. 33R-2200, is also available for use as a blocking control in assays to test for specificity of this FASTKD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FASTKD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FASTKD2 (FAST Kinase Domains 2 (FASTKD2))
- Autre désignation
- FASTKD2 (FASTKD2 Produits)
- Synonymes
- anticorps si:ch211-103i6.5, anticorps KIAA0971, anticorps 2810421I24Rik, anticorps RGD1307883, anticorps FAST kinase domains 2, anticorps FASTKD2, anticorps fastkd2, anticorps Fastkd2
- Sujet
- This gene encodes a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency.
- Poids moléculaire
- 81 kDa (MW of target protein)
-