MASA anticorps (N-Term)

N° du produit ABIN631750

Détail du produit anti-MASA anticorps

Antigène: MASA (ENOPH1) (Enolase-Phosphatase 1 (ENOPH1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MASA est non-conjugé

Application: Western Blotting (WB)

Specificité: ENOPH1 antibody was raised against the N terminal of ENOPH1

Purification: Affinity purified

Immunogène: ENOPH1 antibody was raised using the N terminal of ENOPH1 corresponding to a region with amino acids IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ENOPH1 Blocking Peptide, catalog no. 33R-3937, is also available for use as a blocking control in assays to test for specificity of this ENOPH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENOPH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MASA

Antigène: MASA (ENOPH1) (Enolase-Phosphatase 1 (ENOPH1))

Autre désignation: ENOPH1 (ENOPH1 Produits)

Synonymes: anticorps E1, anticorps MASA, anticorps MST145, anticorps mtnC, anticorps 2310057D15Rik, anticorps BB183658, anticorps C81437, anticorps RGD1309016, anticorps masa, anticorps zgc:91991, anticorps enoph1, anticorps enolase-phosphatase 1, anticorps enolase-phosphatase 1 S homeolog, anticorps Enolase-phosphatase E1, anticorps ENOPH1, anticorps enoph1, anticorps Enoph1, anticorps enoph1.S, anticorps enoph

Sujet: ENOPH1 is a bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).

Poids moléculaire: 29 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process