ELP2 anticorps
-
- Antigène Voir toutes ELP2 Anticorps
- ELP2 (Elongator Acetyltransferase Complex Subunit 2 (ELP2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ELP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ELP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EESGVWLEQVRVGEVGGNTLGFYDCQFNEDGSMIIAHAFHGALHLWKQNT
- Top Product
- Discover our top product ELP2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ELP2 Blocking Peptide, catalog no. 33R-2389, is also available for use as a blocking control in assays to test for specificity of this ELP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ELP2 (Elongator Acetyltransferase Complex Subunit 2 (ELP2))
- Autre désignation
- ELP2 (ELP2 Produits)
- Synonymes
- anticorps zgc:153559, anticorps SHINC-2, anticorps STATIP1, anticorps StIP, anticorps AU023723, anticorps Epl2, anticorps StIP1, anticorps Statip1, anticorps F14J22.24, anticorps elongator protein 2, anticorps elongator acetyltransferase complex subunit 2, anticorps elongator protein 2, anticorps elp2, anticorps ELP2, anticorps Elp2
- Sujet
- ELP2 regulates the ligand-dependent activation of STAT3. ELP2 acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.
- Poids moléculaire
- 92 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus
-