IARS anticorps (N-Term)

N° du produit ABIN631752

Détail du produit anti-IARS anticorps

Antigène: IARS (Isoleucyl-tRNA Synthetase (IARS))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IARS est non-conjugé

Application: Western Blotting (WB)

Specificité: IARS antibody was raised against the N terminal of IARS

Purification: Affinity purified

Immunogène: IARS antibody was raised using the N terminal of IARS corresponding to a region with amino acids SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IARS Blocking Peptide, catalog no. 33R-8554, is also available for use as a blocking control in assays to test for specificity of this IARS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IARS

Antigène: IARS (Isoleucyl-tRNA Synthetase (IARS))

Autre désignation: IARS (IARS Produits)

Sujet: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS.

Poids moléculaire: 144 kDa (MW of target protein)