VARS anticorps (Middle Region)
-
- Antigène Voir toutes VARS Anticorps
- VARS (Valyl-tRNA Synthetase (VARS))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp VARS est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- VARS antibody was raised against the middle region of VARS
- Purification
- Affinity purified
- Immunogène
- VARS antibody was raised using the middle region of VARS corresponding to a region with amino acids VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP
- Top Product
- Discover our top product VARS Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
VARS Blocking Peptide, catalog no. 33R-9521, is also available for use as a blocking control in assays to test for specificity of this VARS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VARS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- VARS (Valyl-tRNA Synthetase (VARS))
- Autre désignation
- VARS (VARS Produits)
- Synonymes
- anticorps G7A, anticorps VARS1, anticorps VARS2, anticorps VARS, anticorps Bat6, anticorps D17H6S56E, anticorps G7a, anticorps Vars2, anticorps vars1, anticorps vars2, anticorps CHUNP6879, anticorps im:7137378, anticorps wu:fb07a11, anticorps wu:fb07d10, anticorps TrsVal, anticorps BEST:LD45671, anticorps CG4062, anticorps Dmel\\CG4062, anticorps VRS, anticorps ValRS, anticorps l(2)03531, anticorps l(2)rI255, anticorps ld45671, anticorps ECK4251, anticorps JW4215, anticorps val-act, anticorps T5E21.11, anticorps T5E21_11, anticorps TWIN 2, anticorps VALRS, anticorps VALYL TRNA SYNTHETASE, anticorps valyl-tRNA synthetase, anticorps Valyl-tRNA synthetase, anticorps valyl-tRNA synthetase S homeolog, anticorps hypothetical protein, anticorps valyl-tRNA synthetase 2, mitochondrial, anticorps valyl-tRNA synthetase / valine-tRNA ligase (VALRS), anticorps VARS, anticorps Vars, anticorps vars, anticorps ValRS, anticorps vars.S, anticorps MW0078, anticorps Pnap_3169, anticorps valS, anticorps Fnod_0343, anticorps Cyan7425_1070, anticorps Tola_0553, anticorps Slip_0680, anticorps Astex_3136, anticorps ML5_3395, anticorps VARS2, anticorps TWN2
- Sujet
- Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. VARS belongs to class-I aminoacyl-tRNA synthetase family and is located in the class III region of the major histocompatibility complex.
- Poids moléculaire
- 140 kDa (MW of target protein)
-