PSAT1 anticorps (N-Term)
-
- Antigène Voir toutes PSAT1 Anticorps
- PSAT1 (phosphoserine Aminotransferase 1 (PSAT1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSAT1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- PSAT1 antibody was raised against the N terminal of PSAT1
- Purification
- Affinity purified
- Immunogène
- PSAT1 antibody was raised using the N terminal of PSAT1 corresponding to a region with amino acids ADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASY
- Top Product
- Discover our top product PSAT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PSAT1 Blocking Peptide, catalog no. 33R-1111, is also available for use as a blocking control in assays to test for specificity of this PSAT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSAT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PSAT1 (phosphoserine Aminotransferase 1 (PSAT1))
- Autre désignation
- PSAT1 (PSAT1 Produits)
- Synonymes
- anticorps fi15b02, anticorps wu:fi15b02, anticorps zgc:55738, anticorps zgc:77622, anticorps EPIP, anticorps PSA, anticorps PSAT, anticorps D8Ertd814e, anticorps Psat, anticorps Psa1, anticorps phosphoserine aminotransferase 1, anticorps phosphoserine aminotransferase 1 L homeolog, anticorps psat1, anticorps psat1.L, anticorps PSAT1, anticorps Psat1
- Sujet
- PSAT1 is likely a phosphoserine aminotransferase, based on similarity to proteins in mouse, rabbit, and Drosophila.
- Poids moléculaire
- 40 kDa (MW of target protein)
- Pathways
- L'effet Warburg
-