KLRAQ1 anticorps (N-Term)

N° du produit ABIN631762

Détail du produit anti-KLRAQ1 anticorps

Antigène: KLRAQ1 (KLRAQ Motif Containing 1 (KLRAQ1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLRAQ1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CCDC128 antibody was raised against the N terminal of CCDC128

Purification: Affinity purified

Immunogène: CCDC128 antibody was raised using the N terminal of CCDC128 corresponding to a region with amino acids KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDLQKKIEENE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC128 Blocking Peptide, catalog no. 33R-4637, is also available for use as a blocking control in assays to test for specificity of this CCDC128 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC128 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KLRAQ1

Antigène: KLRAQ1 (KLRAQ Motif Containing 1 (KLRAQ1))

Autre désignation: CCDC128 (KLRAQ1 Produits)

Synonymes: anticorps KLRAQ1, anticorps CCDC128, anticorps ccdc128, anticorps klraq1, anticorps 1110018J12Rik, anticorps AI426045, anticorps AW550781, anticorps Ccdc128, anticorps Klraq1, anticorps protein phosphatase 1 regulatory subunit 21, anticorps protein phosphatase 1 regulatory subunit 21 L homeolog, anticorps protein phosphatase 1, regulatory subunit 21, anticorps PPP1R21, anticorps ppp1r21.L, anticorps Ppp1r21

Sujet: The function of CCDC128 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 87 kDa (MW of target protein)