EIF5 anticorps (N-Term)

N° du produit ABIN631763

Détail du produit anti-EIF5 anticorps

Antigène: EIF5 (Eukaryotic Translation Initiation Factor 5 (EIF5))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF5 est non-conjugé

Application: Western Blotting (WB)

Specificité: EIF5 antibody was raised against the N terminal of EIF5

Purification: Affinity purified

Immunogène: EIF5 antibody was raised using the N terminal of EIF5 corresponding to a region with amino acids SVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF5 Blocking Peptide, catalog no. 33R-8921, is also available for use as a blocking control in assays to test for specificity of this EIF5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF5

Antigène: EIF5 (Eukaryotic Translation Initiation Factor 5 (EIF5))

Autre désignation: EIF5 (EIF5 Produits)

Synonymes: anticorps fb37c12, anticorps fb54h04, anticorps zgc:56606, anticorps zgc:77026, anticorps wu:fb37c12, anticorps wu:fb54h04, anticorps CG9177, anticorps Dmel\\CG9177, anticorps EIf5, anticorps anon-EST:fe3C6, anticorps eIF-5, anticorps EIF-5, anticorps EIF-5A, anticorps 2810011H21Rik, anticorps D12Ertd549e, anticorps eukaryotic translation initiation factor 5, anticorps CG9177 gene product from transcript CG9177-RD, anticorps eukaryotic translation initiation factor 5 S homeolog, anticorps Eukaryotic initiation factor-5, anticorps eif5, anticorps EIF5, anticorps eIF5, anticorps eif5.S, anticorps Eif5

Sujet: EIF5 catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex.

Poids moléculaire: 49 kDa (MW of target protein)