NAPEPLD anticorps (N-Term)

N° du produit ABIN631766

Détail du produit anti-NAPEPLD anticorps

Antigène: NAPEPLD (N-Acyl Phosphatidylethanolamine phospholipase D (NAPEPLD))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NAPEPLD est non-conjugé

Application: Western Blotting (WB)

Specificité: NAPE-PLD antibody was raised against the N terminal Of Nape-Pld

Purification: Affinity purified

Immunogène: NAPE-PLD antibody was raised using the N terminal Of Nape-Pld corresponding to a region with amino acids TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NAPE-PLD Blocking Peptide, catalog no. 33R-9379, is also available for use as a blocking control in assays to test for specificity of this NAPE-PLD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAPE-PLD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NAPEPLD

Antigène: NAPEPLD (N-Acyl Phosphatidylethanolamine phospholipase D (NAPEPLD))

Autre désignation: NAPE-PLD (NAPEPLD Produits)

Synonymes: anticorps FMP30, anticorps NAPE-PLD, anticorps A530089G06, anticorps Mbldc1, anticorps N-acyl phosphatidylethanolamine phospholipase D, anticorps NAPEPLD, anticorps Napepld

Sujet: NAPE-PLD hydrolyzes N-acyl-phosphatidylethanolamines (NAPEs) to produce N-acylethanolamines (NAEs) and phosphatidic acid. NAPE-PLD is responsible for the generation of anandamide (N-arachidonoylethanolamine).

Poids moléculaire: 45 kDa (MW of target protein)