LCA5L anticorps (N-Term)

N° du produit ABIN631770

Détail du produit anti-LCA5L anticorps

Antigène: LCA5L (Leber Congenital Amaurosis 5-Like (LCA5L))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LCA5L est non-conjugé

Application: Western Blotting (WB)

Specificité: C21 ORF13 antibody was raised against the N terminal Of C21 rf13

Purification: Affinity purified

Immunogène: C21 ORF13 antibody was raised using the N terminal Of C21 rf13 corresponding to a region with amino acids SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C21ORF13 Blocking Peptide, catalog no. 33R-8574, is also available for use as a blocking control in assays to test for specificity of this C21ORF13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LCA5L

Antigène: LCA5L (Leber Congenital Amaurosis 5-Like (LCA5L))

Autre désignation: C21ORF13 (LCA5L Produits)

Synonymes: anticorps C21orf13, anticorps 4921526F01Rik, anticorps Lcca5l, anticorps Leber congenital amaurosis 5-like, anticorps LCA5L, lebercilin like, anticorps LCA5L, anticorps Lca5l

Sujet: The function of the C21orf13 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 76 kDa (MW of target protein)