Primary Retinal Dysplasia (PRD) (Middle Region) anticorps

N° du produit ABIN631772

Détail du produit

Antigène: Primary Retinal Dysplasia (PRD)

Épitope: Middle Region

Reactivité: Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: PRD antibody was raised against the middle region of PRD

Purification: Affinity purified

Immunogène: PRD antibody was raised using the middle region of PRD corresponding to a region with amino acids MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRD Blocking Peptide, catalog no. 33R-6573, is also available for use as a blocking control in assays to test for specificity of this PRD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Primary Retinal Dysplasia (PRD)

Autre désignation: PRD (PRD Produits)

Synonymes: anticorps CG6716, anticorps Dmel\\CG6716, anticorps PRD, anticorps Prd, anticorps pr, anticorps paired, anticorps primary retinal dysplasia, anticorps prd, anticorps PRD

Sujet: Prd is a pair-rule protein expressed in a segmentally repeating pattern to define the polarity of embryonic segments.

Poids moléculaire: 65 kDa (MW of target protein)