DCAF12 anticorps (N-Term)

N° du produit ABIN631786

Détail du produit anti-DCAF12 anticorps

Antigène: DCAF12 (DDB1 and CUL4 Associated Factor 12 (DCAF12))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DCAF12 est non-conjugé

Application: Western Blotting (WB)

Specificité: WDR40 A antibody was raised against the N terminal of WDR40

Purification: Affinity purified

Immunogène: WDR40 A antibody was raised using the N terminal of WDR40 corresponding to a region with amino acids ARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR40A Blocking Peptide, catalog no. 33R-1481, is also available for use as a blocking control in assays to test for specificity of this WDR40A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DCAF12

Antigène: DCAF12 (DDB1 and CUL4 Associated Factor 12 (DCAF12))

Autre désignation: WDR40A (DCAF12 Produits)

Synonymes: anticorps CT102, anticorps KIAA1892, anticorps TCC52, anticorps WDR40A, anticorps 1500001L20Rik, anticorps 5830424K06Rik, anticorps AA420338, anticorps AI851081, anticorps Wdr40a, anticorps wdr40a, anticorps wu:fb93d04, anticorps zgc:154031, anticorps wdr40b, anticorps dcaf12, anticorps wdr40a-a, anticorps DDB1 and CUL4 associated factor 12, anticorps DDB1 and CUL4 associated factor 12 L homeolog, anticorps DCAF12, anticorps Dcaf12, anticorps dcaf12, anticorps dcaf12.L

Sujet: WDR40A is believed to be involved in protein binding.

Poids moléculaire: 50 kDa (MW of target protein)