POC1B anticorps (N-Term)

N° du produit ABIN631788

Détail du produit anti-POC1B anticorps

Antigène: POC1B (POC1 Centriolar Protein Homolog B (POC1B))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POC1B est non-conjugé

Application: Western Blotting (WB)

Specificité: WDR51 B antibody was raised against the N terminal of WDR51

Purification: Affinity purified

Immunogène: WDR51 B antibody was raised using the N terminal of WDR51 corresponding to a region with amino acids GNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATAS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR51B Blocking Peptide, catalog no. 33R-3452, is also available for use as a blocking control in assays to test for specificity of this WDR51B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POC1B

Antigène: POC1B (POC1 Centriolar Protein Homolog B (POC1B))

Autre désignation: WDR51B (POC1B Produits)

Synonymes: anticorps PIX1, anticorps TUWD12, anticorps WDR51B, anticorps 4933430F16Rik, anticorps Wdr51b, anticorps fl36w17, anticorps wdr51b, anticorps wu:fl36w17, anticorps zgc:63538, anticorps POC1 centriolar protein B, anticorps POC1B, anticorps Poc1b, anticorps poc1b

Sujet: WDR51B contains 7 WD repeats. The function of the WDR51B protein remains unknown.

Poids moléculaire: 54 kDa (MW of target protein)