ATXN7L1 anticorps (Middle Region)

N° du produit ABIN631793

Détail du produit anti-ATXN7L1 anticorps

Antigène: ATXN7L1 (Ataxin 7-Like 1 (ATXN7L1))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATXN7L1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ATXN7 L1 antibody was raised against the middle region of ATXN7 1

Purification: Affinity purified

Immunogène: ATXN7 L1 antibody was raised using the middle region of ATXN7 1 corresponding to a region with amino acids KVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATXN7L1 Blocking Peptide, catalog no. 33R-4717, is also available for use as a blocking control in assays to test for specificity of this ATXN7L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATXN0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATXN7L1

Antigène: ATXN7L1 (Ataxin 7-Like 1 (ATXN7L1))

Autre désignation: ATXN7L1 (ATXN7L1 Produits)

Synonymes: anticorps ATXN7L4, anticorps 2810423G08Rik, anticorps Atxn7l4, anticorps ATXN7L1, anticorps RGD1305730, anticorps RGD1564242, anticorps ataxin 7 like 1, anticorps ataxin 7-like 1, anticorps ataxin-7-like protein 1, anticorps ATXN7L1, anticorps Atxn7l1, anticorps atxn7l1, anticorps LOC100598692

Sujet: The function of ATXN7L1 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 16 kDa (MW of target protein)