LCN8 anticorps (N-Term)

N° du produit ABIN631798

Détail du produit anti-LCN8 anticorps

Antigène: LCN8 (Lipocalin 8 (LCN8))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LCN8 est non-conjugé

Application: Western Blotting (WB)

Specificité: Lipocalin 8 antibody was raised against the N terminal of LCN8

Purification: Affinity purified

Immunogène: Lipocalin 8 antibody was raised using the N terminal of LCN8 corresponding to a region with amino acids EELDRQKIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Lipocalin 8 Blocking Peptide, catalog no. 33R-2370, is also available for use as a blocking control in assays to test for specificity of this Lipocalin 8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCN8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LCN8

Antigène: LCN8 (Lipocalin 8 (LCN8))

Autre désignation: Lipocalin 8 (LCN8 Produits)

Synonymes: anticorps ESP20.5, anticorps EP17, anticorps LCN5, anticorps 9230106L18Rik, anticorps Lcn5, anticorps mEP17, anticorps RGD1306747, anticorps lipocalin 8, anticorps LCN8, anticorps Lcn8

Sujet: Members of the lipocalin family, such as LCN8, have a common structure consisting of an 8-stranded antiparallel beta-barrel that forms a cup-shaped ligand-binding pocket or calyx.

Poids moléculaire: 17 kDa (MW of target protein)