KRT17 anticorps (C-Term)

N° du produit ABIN631802

Détail du produit anti-KRT17 anticorps

Antigène: KRT17 (Keratin 17 (KRT17))

Épitope: C-Term

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KRT17 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: Cytokeratin 17 antibody was raised against the C terminal of KRT17

Purification: Affinity purified

Immunogène: Cytokeratin 17 antibody was raised using the C terminal of KRT17 corresponding to a region with amino acids IATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKVISSREQVHQT

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cytokeratin 17 Blocking Peptide, catalog no. 33R-3900, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 17 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KRT17

Antigène: KRT17 (Keratin 17 (KRT17))

Autre désignation: Cytokeratin 17 (KRT17 Produits)

Synonymes: anticorps K17, anticorps Krt1-17, anticorps PC, anticorps PC2, anticorps PCHC1, anticorps Ka17, anticorps KRT17, anticorps krt16, anticorps si:dkeyp-113d7.7, anticorps KRT14, anticorps keratin 17, anticorps keratin 17 L homeolog, anticorps keratin 17, type I, anticorps keratin, type I cytoskeletal 17, anticorps Krt17, anticorps KRT17, anticorps krt17, anticorps krt17.L, anticorps LOC100737113, anticorps LOC102177275

Sujet: KRT17 is type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in its gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.KRT17 encodes the type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in this gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.

Poids moléculaire: 48 kDa (MW of target protein)