LRRC57 anticorps (N-Term)

N° du produit ABIN631803

Détail du produit anti-LRRC57 anticorps

Antigène: LRRC57 (Leucine Rich Repeat Containing 57 (LRRC57))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC57 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRC57 antibody was raised against the N terminal of LRRC57

Purification: Affinity purified

Immunogène: LRRC57 antibody was raised using the N terminal of LRRC57 corresponding to a region with amino acids MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC57 Blocking Peptide, catalog no. 33R-6050, is also available for use as a blocking control in assays to test for specificity of this LRRC57 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC57 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC57

Antigène: LRRC57 (Leucine Rich Repeat Containing 57 (LRRC57))

Autre désignation: LRRC57 (LRRC57 Produits)

Synonymes: anticorps zgc:92240, anticorps 2810002D13Rik, anticorps AA407405, anticorps RGD1307128, anticorps leucine rich repeat containing 57, anticorps leucine rich repeat containing 57 L homeolog, anticorps lrrc57, anticorps lrrc57.L, anticorps LRRC57, anticorps Lrrc57

Sujet: LRRC57 is a member of the leucine-rich repeat family of proteins, which are known to be involved in protein-protein interactions.

Poids moléculaire: 27 kDa (MW of target protein)