C10ORF96 anticorps (Middle Region)

N° du produit ABIN631805

Détail du produit anti-C10ORF96 anticorps

Antigène: C10ORF96 (C10orf96) (Chromosome 10 Open Reading Frame 96 (C10orf96))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C10ORF96 est non-conjugé

Application: Western Blotting (WB)

Specificité: C10 ORF96 antibody was raised against the middle region of C10 rf96

Purification: Affinity purified

Immunogène: C10 ORF96 antibody was raised using the middle region of C10 rf96 corresponding to a region with amino acids QANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENES

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C10ORF96 Blocking Peptide, catalog no. 33R-7472, is also available for use as a blocking control in assays to test for specificity of this C10ORF96 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF96 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C10ORF96

Antigène: C10ORF96 (C10orf96) (Chromosome 10 Open Reading Frame 96 (C10orf96))

Autre désignation: C10ORF96 (C10orf96 Produits)

Synonymes: anticorps C9H10orf96, anticorps C10orf96, anticorps C26H10orf96, anticorps 1700011F14Rik, anticorps coiled-coil domain containing 172, anticorps coiled-coil domain containing 172 L homeolog, anticorps CCDC172, anticorps Ccdc172, anticorps ccdc172.L

Sujet: The function of Chromosome 10 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 31 kDa (MW of target protein)