AXUD1 anticorps (Middle Region)
-
- Antigène Voir toutes AXUD1 (CSRNP1) Anticorps
- AXUD1 (CSRNP1) (Cysteine-serine-Rich Nuclear Protein 1 (CSRNP1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AXUD1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- AXUD1 antibody was raised against the middle region of AXUD1
- Purification
- Affinity purified
- Immunogène
- AXUD1 antibody was raised using the middle region of AXUD1 corresponding to a region with amino acids ARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAK
- Top Product
- Discover our top product CSRNP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AXUD1 Blocking Peptide, catalog no. 33R-1498, is also available for use as a blocking control in assays to test for specificity of this AXUD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AXUD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AXUD1 (CSRNP1) (Cysteine-serine-Rich Nuclear Protein 1 (CSRNP1))
- Autre désignation
- AXUD1 (CSRNP1 Produits)
- Synonymes
- anticorps AXUD1, anticorps CSRNP-1, anticorps FAM130B, anticorps TAIP-3, anticorps URAX1, anticorps 4931429D10Rik, anticorps Axud1, anticorps taip-3, anticorps CSRNP1, anticorps axud1, anticorps MGC145297, anticorps fb73e11, anticorps wu:fb73e11, anticorps zgc:66340, anticorps cysteine and serine rich nuclear protein 1, anticorps cysteine-serine-rich nuclear protein 1, anticorps cysteine-serine-rich nuclear protein 1 L homeolog, anticorps cysteine-serine-rich nuclear protein 1b, anticorps CSRNP1, anticorps Csrnp1, anticorps csrnp1, anticorps csrnp1.L, anticorps csrnp1b
- Sujet
- This gene encodes a protein that localizes to the nucleus and expression of this gene is induced in response to elevated levels of axin. The Wnt signalling pathway, which is negatively regulated by axin, is important in axis formation in early development and impaired regulation of this signalling pathway is often involved in tumors. A decreased level of expression of this gene in tumors compared to the level of expression in their corresponding normal tissues suggests that this gene product has a tumor suppressor function.
- Poids moléculaire
- 63 kDa (MW of target protein)
- Pathways
- Platelet-derived growth Factor Receptor Signaling
-