STAMBPL1 anticorps (N-Term)

N° du produit ABIN631818

Détail du produit anti-STAMBPL1 anticorps

Antigène: STAMBPL1 (STAM Binding Protein-Like 1 (STAMBPL1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STAMBPL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: STAMBPL1 antibody was raised against the N terminal of STAMBPL1

Purification: Affinity purified

Immunogène: STAMBPL1 antibody was raised using the N terminal of STAMBPL1 corresponding to a region with amino acids MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STAMBPL1 Blocking Peptide, catalog no. 33R-5863, is also available for use as a blocking control in assays to test for specificity of this STAMBPL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAMBPL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STAMBPL1

Antigène: STAMBPL1 (STAM Binding Protein-Like 1 (STAMBPL1))

Autre désignation: STAMBPL1 (STAMBPL1 Produits)

Synonymes: anticorps amsh-lp, anticorps MGC75962, anticorps MGC84444, anticorps AMSHLP, anticorps DKFZp459M0218, anticorps 1700095N21Rik, anticorps 8230401J17Rik, anticorps ALMalpha, anticorps AMSH-FP, anticorps AMSH-LP, anticorps bA399O19.2, anticorps STAM binding protein like 1, anticorps STAM binding protein like 1 L homeolog, anticorps stambpl1, anticorps stambpl1.L, anticorps STAMBPL1, anticorps Stambpl1

Sujet: STAMBPL1 is a zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains.

Poids moléculaire: 50 kDa (MW of target protein)