KIFAP3 anticorps (Middle Region)
-
- Antigène Voir toutes KIFAP3 Anticorps
- KIFAP3 (Kinesin Associated Protein 3 (KIFAP3))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KIFAP3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KIFAP3 antibody was raised against the middle region of KIFAP3
- Purification
- Affinity purified
- Immunogène
- KIFAP3 antibody was raised using the middle region of KIFAP3 corresponding to a region with amino acids WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG
- Top Product
- Discover our top product KIFAP3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KIFAP3 Blocking Peptide, catalog no. 33R-9970, is also available for use as a blocking control in assays to test for specificity of this KIFAP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIFAP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KIFAP3 (Kinesin Associated Protein 3 (KIFAP3))
- Autre désignation
- KIFAP3 (KIFAP3 Produits)
- Synonymes
- anticorps CG11759, anticorps DmKAP, anticorps DmKap, anticorps Dmel\\CG11759, anticorps KAP, anticorps KAP3, anticorps Kap, anticorps dKAP3, anticorps kap3, anticorps FLA3, anticorps KAP-1, anticorps KAP-3, anticorps SMAP, anticorps Smg-GDS, anticorps dJ190I16.1, anticorps fb99h08, anticorps kifap3, anticorps wu:fb99h08, anticorps wz7228, anticorps Kinesin associated protein 3, anticorps kinesin-associated protein 3, anticorps kinesin associated protein 3, anticorps kinesin-associated protein 3b, anticorps kinesin-associated protein 3 L homeolog, anticorps Kap3, anticorps LOC551999, anticorps KIFAP3, anticorps Kifap3, anticorps kifap3b, anticorps kifap3.L
- Sujet
- The small G protein GDP dissociation stimulator (smg GDS) is a regulator protein having two activities on a group of small G proteins including the Rho and Rap1 family members and Ki-Ras, one is to stimulate their GDP/GTP exchange reactions, and the other is to inhibit their interactions with membranes.
- Poids moléculaire
- 91 kDa (MW of target protein)
- Pathways
- Signalisation Hedgehog, Sensory Perception of Sound
-