ZFP14 anticorps (N-Term)

N° du produit ABIN631822

Détail du produit anti-ZFP14 anticorps

Antigène: ZFP14 (Zinc Finger Protein 14 Homolog (ZFP14))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZFP14 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZNF14 antibody was raised against the N terminal of ZNF14

Purification: Affinity purified

Immunogène: ZNF14 antibody was raised using the N terminal of ZNF14 corresponding to a region with amino acids IYYQPFQRHERTHAGQKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKQC

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZNF14 Blocking Peptide, catalog no. 33R-4231, is also available for use as a blocking control in assays to test for specificity of this ZNF14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZFP14

Antigène: ZFP14 (Zinc Finger Protein 14 Homolog (ZFP14))

Autre désignation: ZNF14 (ZFP14 Produits)

Synonymes: anticorps ZNF531, anticorps Hit40, anticorps Znf14, anticorps GIOT-4, anticorps KOX6, anticorps 4732429I09Rik, anticorps Krox-9, anticorps Zfp-14, anticorps mKIAA1559, anticorps Zfp968, anticorps ZFP14 zinc finger protein, anticorps zinc finger protein 709, anticorps zinc finger protein 14, anticorps ZFP14, anticorps Zfp709, anticorps ZNF14, anticorps Zfp14

Sujet: ZNF14 contains a zinc finger and a Kruppel-associated box (KRAB) domain. KRAB domain is known to be involved in the transcriptional repression of a number of zinc finger proteins.

Poids moléculaire: 71 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin