FBXW10 anticorps (N-Term)

N° du produit ABIN631823

Détail du produit anti-FBXW10 anticorps

Antigène: FBXW10 (F-Box and WD Repeat Domain Containing 10 (FBXW10))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXW10 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXW10 antibody was raised against the N terminal of FBXW10

Purification: Affinity purified

Immunogène: FBXW10 antibody was raised using the N terminal of FBXW10 corresponding to a region with amino acids SPEKDHSSKSATSQVYWTAKTQHTSLPLSKAPENEHLLGAASNPEEPWRN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXW10 Blocking Peptide, catalog no. 33R-8670, is also available for use as a blocking control in assays to test for specificity of this FBXW10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXW10

Antigène: FBXW10 (F-Box and WD Repeat Domain Containing 10 (FBXW10))

Autre désignation: FBXW10 (FBXW10 Produits)

Synonymes: anticorps Fbw10, anticorps HREP, anticorps SM25H2, anticorps SM2SH2, anticorps CMT1A duplicated region transcript 1, anticorps F-box and WD repeat domain containing 10, anticorps tripartite motif containing 16, anticorps F-box and WD-40 domain protein 10, anticorps CDRT1, anticorps FBXW10, anticorps Fbxw10, anticorps Cdrt1, anticorps TRIM16

Sujet: Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Poids moléculaire: 120 kDa (MW of target protein)