TMPRSS3 anticorps (N-Term)
-
- Antigène Voir toutes TMPRSS3 Anticorps
- TMPRSS3 (Transmembrane Protease, Serine 3 (TMPRSS3))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMPRSS3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TMPRSS3 antibody was raised against the N terminal of TMPRSS3
- Purification
- Affinity purified
- Immunogène
- TMPRSS3 antibody was raised using the N terminal of TMPRSS3 corresponding to a region with amino acids MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP
- Top Product
- Discover our top product TMPRSS3 Anticorps primaire
-
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (Internal Region) antibody
TMPRSS3 Reactivité: Humain, Souris WB, ELISA, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (N-Term) antibodyTMPRSS3 Reactivité: Humain, Souris, Rat, Cheval, Chien, Cobaye, Boeuf (Vache), Lapin WB Hôte: Lapin Polyclonal unconjugated
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (C-Term) antibodyTMPRSS3 Reactivité: Humain WB, ELISA, IF Hôte: Lapin Polyclonal unconjugated
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (AA 272-300) antibodyTMPRSS3 Reactivité: Humain WB, IF Hôte: Lapin Polyclonal RB21838 unconjugated
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (AA 119-214) antibodyTMPRSS3 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 2E1 unconjugated
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (C-Term) antibodyTMPRSS3 Reactivité: Humain WB, IHC, IF, IC Hôte: Lapin Polyclonal unconjugated
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (C-Term) antibodyTMPRSS3 Reactivité: Humain WB, ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (C-Term) antibodyTMPRSS3 Reactivité: Humain, Souris WB, ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (AA 420-460) antibodyTMPRSS3 Reactivité: Humain, Souris WB, IHC, IF, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (Internal Region) antibodyVerified TMPRSS3 Reactivité: Humain WB, ELISA Hôte: Chèvre Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMPRSS3 Blocking Peptide, catalog no. 33R-6022, is also available for use as a blocking control in assays to test for specificity of this TMPRSS3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMPRSS3 (Transmembrane Protease, Serine 3 (TMPRSS3))
- Autre désignation
- TMPRSS3 (TMPRSS3 Produits)
- Synonymes
- anticorps TMPRSS3, anticorps DKFZp469L1528, anticorps DFNB10, anticorps DFNB8, anticorps ECHOS1, anticorps TADG12, anticorps transmembrane protease, serine 3, anticorps TMPRSS3, anticorps Tmprss3
- Sujet
- This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a serine protease domain, a transmembrane domain, a LDL receptor-like domain, and a scavenger receptor cysteine-rich domain. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified by its association with both congenital and childhood onset autosomal recessive deafness.
- Poids moléculaire
- 37 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-
