PRRC1 anticorps (Middle Region)

N° du produit ABIN631835

Détail du produit anti-PRRC1 anticorps

Antigène: PRRC1 (Proline-Rich Coiled-Coil 1 (PRRC1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRRC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRRC1 antibody was raised against the middle region of PRRC1

Purification: Affinity purified

Immunogène: PRRC1 antibody was raised using the middle region of PRRC1 corresponding to a region with amino acids VGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRRC1 Blocking Peptide, catalog no. 33R-9551, is also available for use as a blocking control in assays to test for specificity of this PRRC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRRC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRRC1

Antigène: PRRC1 (Proline-Rich Coiled-Coil 1 (PRRC1))

Autre désignation: PRRC1 (PRRC1 Produits)

Synonymes: anticorps MGC75910, anticorps SAG20, anticorps fi37a08, anticorps id:ibd5136, anticorps mys, anticorps t2gtl20, anticorps wu:fi37a08, anticorps zgc:103484, anticorps prrc1, anticorps 1190002C06Rik, anticorps 2310058D16Rik, anticorps 3110038B19Rik, anticorps 9430085A19Rik, anticorps Prcc1, anticorps proline-rich coiled-coil 1, anticorps proline-rich coiled-coil 1 S homeolog, anticorps proline rich coiled-coil 1, anticorps prrc1, anticorps prrc1.S, anticorps PRRC1, anticorps Prrc1

Sujet: The specific function of PRRC1 is not yet known.

Poids moléculaire: 47 kDa (MW of target protein)