DCXR anticorps (Middle Region)

N° du produit ABIN631837

Détail du produit anti-DCXR anticorps

Antigène: DCXR (Dicarbonyl/L-Xylulose Reductase (DCXR))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DCXR est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: DCXR antibody was raised against the middle region of DCXR

Purification: Affinity purified

Immunogène: DCXR antibody was raised using the middle region of DCXR corresponding to a region with amino acids STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DCXR Blocking Peptide, catalog no. 33R-8869, is also available for use as a blocking control in assays to test for specificity of this DCXR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCXR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DCXR

Antigène: DCXR (Dicarbonyl/L-Xylulose Reductase (DCXR))

Autre désignation: DCXR (DCXR Produits)

Synonymes: anticorps DCR, anticorps HCR2, anticorps HCRII, anticorps KIDCR, anticorps P34H, anticorps SDR20C1, anticorps XR, anticorps dcxr, anticorps DCXR, anticorps DER, anticorps 0610038K04Rik, anticorps 1810027P18Rik, anticorps glb, anticorps wu:fa12f09, anticorps zgc:111977, anticorps GLB, anticorps dicarbonyl and L-xylulose reductase, anticorps dicarbonyl/L-xylulose reductase, anticorps dicarbonyl L-xylulose reductase, anticorps L-xylulose reductase, anticorps L-xylulose reductase, putative, anticorps dicarbonyl/L-xylulose reductase L homeolog, anticorps DCXR, anticorps dcxr, anticorps Dcxr, anticorps CNL05930, anticorps NCU09041, anticorps AOR_1_494194, anticorps VDBG_02657, anticorps CGB_D1070C, anticorps dcxr.L

Sujet: DCXR is an enzyme that has both diacetyl reductase and L-xylulose reductase activities.DCXR is an enzyme that has both diacetyl reductase (EC 1.1.1.5) and L-xylulose reductase (EC 1.1.1.10) activities.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process, Monocarboxylic Acid Catabolic Process