C7orf31 anticorps (N-Term)
-
- Antigène Tous les produits C7orf31
- C7orf31 (Chromosome 7 Open Reading Frame 31 (C7orf31))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C7orf31 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C7 ORF31 antibody was raised against the N terminal Of C7 rf31
- Purification
- Affinity purified
- Immunogène
- C7 ORF31 antibody was raised using the N terminal Of C7 rf31 corresponding to a region with amino acids EVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTASEDRYQELRE
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C7ORF31 Blocking Peptide, catalog no. 33R-2789, is also available for use as a blocking control in assays to test for specificity of this C7ORF31 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF31 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C7orf31 (Chromosome 7 Open Reading Frame 31 (C7orf31))
- Autre désignation
- C7ORF31 (C7orf31 Produits)
- Synonymes
- anticorps C7orf31, anticorps chromosome 7 open reading frame 31, anticorps chromosome 2 C7orf31 homolog, anticorps uncharacterized protein C7orf31, anticorps C7orf31, anticorps C2H7orf31, anticorps LOC702969
- Sujet
- The function of C7orf31 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 68 kDa (MW of target protein)
-