Phosphoglucomutase 3 anticorps (Middle Region)
-
- Antigène Voir toutes Phosphoglucomutase 3 (PGM3) Anticorps
- Phosphoglucomutase 3 (PGM3)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Phosphoglucomutase 3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PGM3 antibody was raised against the middle region of PGM3
- Purification
- Affinity purified
- Immunogène
- PGM3 antibody was raised using the middle region of PGM3 corresponding to a region with amino acids GVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEAN
- Top Product
- Discover our top product PGM3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PGM3 Blocking Peptide, catalog no. 33R-3660, is also available for use as a blocking control in assays to test for specificity of this PGM3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGM3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Phosphoglucomutase 3 (PGM3)
- Autre désignation
- PGM3 (PGM3 Produits)
- Synonymes
- anticorps pgm3, anticorps MGC69105, anticorps wu:fc08c11, anticorps wu:fc39c03, anticorps zgc:91932, anticorps PGM3, anticorps AGM1, anticorps PAGM, anticorps PGM 3, anticorps 2810473H05Rik, anticorps Agm1, anticorps BB187688, anticorps C77933, anticorps Pgm-3, anticorps phosphoglucomutase 3 L homeolog, anticorps phosphoglucomutase 3, anticorps phosphoacetylglucosamine mutase, anticorps pgm3.L, anticorps PGM3, anticorps pgm3, anticorps PGTG_05011, anticorps Pgm3
- Sujet
- PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.
- Poids moléculaire
- 60 kDa (MW of target protein)
-