SKA3 anticorps (Middle Region)
-
- Antigène Voir toutes SKA3 Anticorps
- SKA3 (Spindle and Kinetochore Associated Complex Subunit 3 (SKA3))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SKA3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SKA3 antibody was raised against the middle region of SKA3
- Purification
- Affinity purified
- Immunogène
- SKA3 antibody was raised using the middle region of SKA3 corresponding to a region with amino acids EVEDRTSLVLNSDTCFENLTDPSSPTISSYENLLRTPTPPEVTKIPEDIL
- Top Product
- Discover our top product SKA3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SKA3 Blocking Peptide, catalog no. 33R-2779, is also available for use as a blocking control in assays to test for specificity of this SKA3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SKA3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SKA3 (Spindle and Kinetochore Associated Complex Subunit 3 (SKA3))
- Autre désignation
- SKA3 (SKA3 Produits)
- Synonymes
- anticorps C13orf3, anticorps RAMA1, anticorps RGD1307201, anticorps C12H13ORF3, anticorps fc23d11, anticorps si:rp71-68n21.13, anticorps wu:fc23d11, anticorps rama1, anticorps F630043A04Rik, anticorps spindle and kinetochore associated complex subunit 3, anticorps spindle and kinetochore associated complex subunit 3 L homeolog, anticorps SKA3, anticorps Ska3, anticorps ska3, anticorps ska3.L
- Sujet
- This protein is a component of the spindle and kinetochore-associated protein complex that regulates microtubule attachment to the kinetochores during mitosis. The encoded protein localizes to the outer kinetechore and may be required for normal chromosome segregation and cell division. Alternative splicing results in multiple transcript variants.
- Poids moléculaire
- 46 kDa (MW of target protein)
-