GNPDA1 anticorps (C-Term)
-
- Antigène Voir toutes GNPDA1 Anticorps
- GNPDA1 (Glucosamine-6-Phosphate Deaminase 1 (GNPDA1))
-
Épitope
- C-Term
-
Reactivité
- Souris, Humain, Rat, C. elegans
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GNPDA1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GNPDA1 antibody was raised against the C terminal of GNPDA1
- Purification
- Affinity purified
- Immunogène
- GNPDA1 antibody was raised using the C terminal of GNPDA1 corresponding to a region with amino acids EGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVD
- Top Product
- Discover our top product GNPDA1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GNPDA1 Blocking Peptide, catalog no. 33R-2449, is also available for use as a blocking control in assays to test for specificity of this GNPDA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNPDA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GNPDA1 (Glucosamine-6-Phosphate Deaminase 1 (GNPDA1))
- Autre désignation
- GNPDA1 (GNPDA1 Produits)
- Synonymes
- anticorps GNP1, anticorps GNPDA, anticorps GNPI, anticorps GPI, anticorps HLN, anticorps Gnp1, anticorps Gnpi, anticorps oscillin, anticorps gnpda, anticorps gnpi, anticorps gpi, anticorps hln, anticorps GNPDA1, anticorps zgc:110691, anticorps glucosamine-6-phosphate deaminase 1, anticorps glucosamine-6-phosphate deaminase 1 S homeolog, anticorps Glucosamine-6-phosphate deaminase 1, anticorps GNPDA1, anticorps Gnpda1, anticorps gnpda1.S, anticorps gnpda1, anticorps MSMEG_0501, anticorps nagB, anticorps PPSC2_c4268
- Sujet
- GNPDA1 belongs to the glucosamine/galactosamine-6-phosphate isomerase family.It seems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo.
- Poids moléculaire
- 33 kDa (MW of target protein)
-