THOC6 anticorps
-
- Antigène Voir toutes THOC6 Anticorps
- THOC6 (THO Complex 6 Homolog (THOC6))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp THOC6 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- THOC6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVR
- Top Product
- Discover our top product THOC6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
THOC6 Blocking Peptide, catalog no. 33R-1196, is also available for use as a blocking control in assays to test for specificity of this THOC6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- THOC6 (THO Complex 6 Homolog (THOC6))
- Autre désignation
- THOC6 (THOC6 Produits)
- Synonymes
- anticorps WDR58, anticorps fSAP35, anticorps F830014G06Rik, anticorps Wdr58, anticorps Pdrp, anticorps zgc:101618, anticorps thoc6, anticorps THO complex 6, anticorps THO complex 6 homolog (Drosophila), anticorps THO complex 6 L homeolog, anticorps THOC6, anticorps Thoc6, anticorps thoc6, anticorps thoc6.L
- Sujet
- THOC6 belongs to the WD repeat THOC6 family.It contains 7 WD repeats. The function of the THOC6 protein remains unknown.
- Poids moléculaire
- 37 kDa (MW of target protein)
-