ROPN1B anticorps (N-Term)

N° du produit ABIN631847

Détail du produit anti-ROPN1B anticorps

Antigène: ROPN1B (Ropporin, Rhophilin Associated Protein 1B (ROPN1B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ROPN1B est non-conjugé

Application: Western Blotting (WB)

Specificité: ROPN1 B antibody was raised against the N terminal of ROPN1

Purification: Affinity purified

Immunogène: ROPN1 B antibody was raised using the N terminal of ROPN1 corresponding to a region with amino acids DYFEALSRGETPPVRERSERVALCNWAELTPELLKILHSQVAGRLIIRAE

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ROPN1B Blocking Peptide, catalog no. 33R-2236, is also available for use as a blocking control in assays to test for specificity of this ROPN1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ROPN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ROPN1B

Antigène: ROPN1B (Ropporin, Rhophilin Associated Protein 1B (ROPN1B))

Autre désignation: ROPN1B (ROPN1B Produits)

Synonymes: anticorps rhophilin associated tail protein 1B, anticorps ROPN1B

Sujet: ROPN1B belongs to the ropporin family and contains 1 RIIa domain. ROPN1B interacts with RHPN1 and AKAP3. It may interact with SPA17.

Poids moléculaire: 24 kDa (MW of target protein)