CPN2 anticorps (N-Term)

N° du produit ABIN631849

Détail du produit anti-CPN2 anticorps

Antigène: CPN2 (Carboxypeptidase N Subunit 2 (CPN2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPN2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Carboxypeptidase N2 antibody was raised against the N terminal of CPN2

Purification: Affinity purified

Immunogène: Carboxypeptidase N2 antibody was raised using the N terminal of CPN2 corresponding to a region with amino acids FTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Carboxypeptidase N2 Blocking Peptide, catalog no. 33R-3103, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase N2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPN2

Antigène: CPN2 (Carboxypeptidase N Subunit 2 (CPN2))

Autre désignation: Carboxypeptidase N2 (CPN2 Produits)

Synonymes: anticorps cpn2, anticorps im:7138819, anticorps Cpn2, anticorps GB13055, anticorps DKFZp470I1612, anticorps ACBP, anticorps 1300018K11Rik, anticorps RGD1305170, anticorps carboxypeptidase N subunit 2, anticorps zgc:153913, anticorps carboxypeptidase N, polypeptide 2, anticorps CPN2, anticorps zgc:153913, anticorps Cpn2, anticorps CpipJ_CPIJ008561, anticorps CpipJ_CPIJ010495, anticorps CpipJ_CPIJ013628

Sujet: CPN2 contains 13 LRR (leucine-rich) repeats. The 83 kDa subunit binds and stabilizes the catalytic subunit at 37 degrees Celsius and keeps it in circulation. Under some circumstances it may be an allosteric modifier of the catalytic subunit.

Poids moléculaire: 60 kDa (MW of target protein)