CCDC38 anticorps (N-Term)
-
- Antigène Voir toutes CCDC38 Anticorps
- CCDC38 (Coiled-Coil Domain Containing 38 (CCDC38))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CCDC38 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CCDC38 antibody was raised against the N terminal of CCDC38
- Purification
- Affinity purified
- Immunogène
- CCDC38 antibody was raised using the N terminal of CCDC38 corresponding to a region with amino acids RERQLKKAEKKLQDDALAFEEFLRENDQRSVDALKMAAQETINKLQMTAE
- Top Product
- Discover our top product CCDC38 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CCDC38 Blocking Peptide, catalog no. 33R-7886, is also available for use as a blocking control in assays to test for specificity of this CCDC38 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC38 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CCDC38 (Coiled-Coil Domain Containing 38 (CCDC38))
- Autre désignation
- CCDC38 (CCDC38 Produits)
- Synonymes
- anticorps 4933417K05Rik, anticorps RGD1564046, anticorps coiled-coil domain containing 38, anticorps CCDC38, anticorps Ccdc38
- Sujet
- The specific function of CCDC38 is not yet known.
- Poids moléculaire
- 65 kDa (MW of target protein)
-