FAM83B anticorps (C-Term)

N° du produit ABIN631856

Détail du produit anti-FAM83B anticorps

Antigène: FAM83B (Family with Sequence Similarity 83, Member B (FAM83B))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM83B est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM83 B antibody was raised against the C terminal of FAM83

Purification: Affinity purified

Immunogène: FAM83 B antibody was raised using the C terminal of FAM83 corresponding to a region with amino acids PRRKHSSSSNSQGSIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM83B Blocking Peptide, catalog no. 33R-7342, is also available for use as a blocking control in assays to test for specificity of this FAM83B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM83B

Antigène: FAM83B (Family with Sequence Similarity 83, Member B (FAM83B))

Autre désignation: FAM83B (FAM83B Produits)

Synonymes: anticorps fam83b, anticorps C6orf143, anticorps C530008M07Rik, anticorps Gm516, anticorps family with sequence similarity 83, member B, anticorps family with sequence similarity 83 member B, anticorps fam83b, anticorps FAM83B, anticorps Fam83b

Sujet: The function of FAM83B protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 115 kDa (MW of target protein)