FAM83B anticorps (C-Term)
-
- Antigène Tous les produits FAM83B
- FAM83B (Family with Sequence Similarity 83, Member B (FAM83B))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FAM83B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FAM83 B antibody was raised against the C terminal of FAM83
- Purification
- Affinity purified
- Immunogène
- FAM83 B antibody was raised using the C terminal of FAM83 corresponding to a region with amino acids PRRKHSSSSNSQGSIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKF
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FAM83B Blocking Peptide, catalog no. 33R-7342, is also available for use as a blocking control in assays to test for specificity of this FAM83B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FAM83B (Family with Sequence Similarity 83, Member B (FAM83B))
- Autre désignation
- FAM83B (FAM83B Produits)
- Synonymes
- anticorps fam83b, anticorps C6orf143, anticorps C530008M07Rik, anticorps Gm516, anticorps family with sequence similarity 83, member B, anticorps family with sequence similarity 83 member B, anticorps fam83b, anticorps FAM83B, anticorps Fam83b
- Sujet
- The function of FAM83B protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 115 kDa (MW of target protein)
-