CENPI anticorps (N-Term)

N° du produit ABIN631857

Détail du produit anti-CENPI anticorps

Antigène: CENPI (Centromere Protein I (CENPI))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CENPI est non-conjugé

Application: Western Blotting (WB)

Specificité: CENPI antibody was raised against the N terminal of CENPI

Purification: Affinity purified

Immunogène: CENPI antibody was raised using the N terminal of CENPI corresponding to a region with amino acids SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CENPI Blocking Peptide, catalog no. 33R-8690, is also available for use as a blocking control in assays to test for specificity of this CENPI antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPI antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CENPI

Antigène: CENPI (Centromere Protein I (CENPI))

Autre désignation: CENPI (CENPI Produits)

Synonymes: anticorps im:7159077, anticorps wu:fi32d01, anticorps CENP-I, anticorps FSHPRH1, anticorps LRPR1, anticorps Mis6, anticorps AI504163, anticorps Fshprh1, anticorps RNALRP, anticorps centromere protein I, anticorps CENPI, anticorps cenpi, anticorps Cenpi

Sujet: CENPI is involved in the response of gonadal tissues to follicle-stimulating hormone. The gene encoding CENPI is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis. The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis.

Poids moléculaire: 87 kDa (MW of target protein)