KANK3 anticorps (N-Term)

N° du produit ABIN631860

Détail du produit anti-KANK3 anticorps

Antigène: KANK3 (KN Motif and Ankyrin Repeat Domains 3 (KANK3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KANK3 est non-conjugé

Application: Western Blotting (WB)

Specificité: ANKRD47 antibody was raised against the N terminal Of Ankrd47

Purification: Affinity purified

Immunogène: ANKRD47 antibody was raised using the N terminal Of Ankrd47 corresponding to a region with amino acids GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANKRD47 Blocking Peptide, catalog no. 33R-3467, is also available for use as a blocking control in assays to test for specificity of this ANKRD47 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD47 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KANK3

Antigène: KANK3 (KN Motif and Ankyrin Repeat Domains 3 (KANK3))

Autre désignation: ANKRD47 (KANK3 Produits)

Synonymes: anticorps ANKRD47, anticorps 0610013D04Rik, anticorps Ankrd47, anticorps D17Ertd288e, anticorps NG28, anticorps RGD1308853, anticorps KN motif and ankyrin repeat domains 3, anticorps KANK3, anticorps Kank3

Sujet: The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 86 kDa (MW of target protein)