FN3KRP anticorps (N-Term)

N° du produit ABIN631861

Détail du produit anti-FN3KRP anticorps

Antigène: FN3KRP (Fructosamine 3 Kinase Related Protein (FN3KRP))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FN3KRP est non-conjugé

Application: Western Blotting (WB)

Specificité: FN3 KRP antibody was raised against the N terminal of FN3 RP

Purification: Affinity purified

Immunogène: FN3 KRP antibody was raised using the N terminal of FN3 RP corresponding to a region with amino acids MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FN3KRP Blocking Peptide, catalog no. 33R-5857, is also available for use as a blocking control in assays to test for specificity of this FN3KRP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FN0 RP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FN3KRP

Antigène: FN3KRP (Fructosamine 3 Kinase Related Protein (FN3KRP))

Autre désignation: FN3KRP (FN3KRP Produits)

Synonymes: anticorps FN3KL, anticorps FN3K-RP, anticorps fn3k, anticorps fn3kl, anticorps MGC145992, anticorps DKFZP469K211, anticorps RGD1304570, anticorps zgc:101634, anticorps fructosamine 3 kinase related protein, anticorps fructosamine-3-kinase-related protein, anticorps FN3KRP, anticorps Fn3krp, anticorps fn3krp

Sujet: FN3KRP phosphorylates psicosamines and ribulosamines, but not fructosamines, on the third carbon of the sugar moiety. Protein-bound psicosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions. Thus phosphorylation leads to deglycation.

Poids moléculaire: 34 kDa (MW of target protein)