KRT8 anticorps (N-Term)
-
- Antigène Voir toutes KRT8 Anticorps
- KRT8 (Keratin 8 (KRT8))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KRT8 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- Cytokeratin 8 antibody was raised against the N terminal of KRT8
- Purification
- Affinity purified
- Immunogène
- Cytokeratin 8 antibody was raised using the N terminal of KRT8 corresponding to a region with amino acids MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL
- Top Product
- Discover our top product KRT8 Anticorps primaire
-
anti-Keratin 8 (KRT8) antibody
KRT8 Reactivité: Humain, Souris WB, IHC, FACS, ICC, IHC (fro) Hôte: Souris Monoclonal M20 unconjugated
anti-Keratin 8 (KRT8) (AA 92-393) antibodyKRT8 Reactivité: Humain WB, IHC, ICC, IP Hôte: Lapin Polyclonal unconjugated
anti-Keratin 8 (KRT8) (Ser726), (Ser731) antibodyKRT8 Reactivité: Humain WB, ELISA, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Keratin 8 (KRT8) antibodyKRT8 Reactivité: Humain, Rat, Poisson zèbre (Danio rerio) WB, IF, IHC, FACS, StM Hôte: Souris Monoclonal H1 unconjugated
anti-Keratin 8 (KRT8) (pSer432) antibodyKRT8 Reactivité: Humain, Rat, Souris WB, IF, IHC, ELISA, ICC Hôte: Lapin Polyclonal unconjugated
anti-Keratin 8 (KRT8) (AA 1-483) antibodyKRT8 Reactivité: Humain WB, IF, IHC Hôte: Lapin Polyclonal unconjugated
anti-Keratin 8 (KRT8) (AA 91-381) antibodyKRT8 Reactivité: Humain, Rat, Singe, Chien WB, IF, IHC, IHC (p) Hôte: Souris Monoclonal 1B12 unconjugated
anti-Keratin 8 (KRT8) (AA 391-483) antibodyKRT8 Reactivité: Humain WB, IHC, ELISA, ICC Hôte: Souris Monoclonal 8A5D12 unconjugated
anti-Keratin 8 (KRT8) antibodyKRT8 Reactivité: Humain, Boeuf (Vache), Porc, Lapin, Mouton IF, IHC, FACS, StM Hôte: Souris Monoclonal B22-1 unconjugated
anti-Keratin 8 (KRT8) (N-Term) antibodyKRT8 Reactivité: Humain, Rat, Souris, Boeuf (Vache), Chien, Cobaye, Cheval, Saccharomyces cerevisiae WB, IHC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Cytokeratin 8 Blocking Peptide, catalog no. 33R-6446, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KRT8 (Keratin 8 (KRT8))
- Autre désignation
- Cytokeratin 8 (KRT8 Produits)
- Synonymes
- anticorps CARD2, anticorps CK-8, anticorps CK8, anticorps CYK8, anticorps K2C8, anticorps K8, anticorps KO, anticorps AA960620, anticorps AL022697, anticorps AU019895, anticorps Card2, anticorps EndoA, anticorps Krt-2.8, anticorps Krt2-8, anticorps CYKER, anticorps KRT2-8, anticorps KERATIN8, anticorps ck8, anticorps cyk8, anticorps k2c8, anticorps card2, anticorps krt2-5, anticorps MGC69490, anticorps KRT8, anticorps DreK8, anticorps cb186, anticorps krt2-8, anticorps sb:cb186, anticorps wu:fa20h05, anticorps wu:fa95h10, anticorps wu:fb96c06, anticorps zf-K8, anticorps zfk8, anticorps DKFZp468F2127, anticorps keratin 8, anticorps keratin 8 S homeolog, anticorps KRT8, anticorps Krt8, anticorps krt8.S, anticorps krt8
- Sujet
- KRT8 together with KRT19, help to link the contractile apparatus to dystrophin at the costameres of striated muscle.
- Poids moléculaire
- 53 kDa (MW of target protein)
-
