DPPA4 anticorps (N-Term)

N° du produit ABIN631866

Détail du produit anti-DPPA4 anticorps

Antigène: DPPA4 (Developmental Pluripotency Associated 4 (DPPA4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DPPA4 est non-conjugé

Application: Western Blotting (WB)

Specificité: DPPA4 antibody was raised against the N terminal of DPPA4

Purification: Affinity purified

Immunogène: DPPA4 antibody was raised using the N terminal of DPPA4 corresponding to a region with amino acids MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DPPA4 Blocking Peptide, catalog no. 33R-6210, is also available for use as a blocking control in assays to test for specificity of this DPPA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPPA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DPPA4

Antigène: DPPA4 (Developmental Pluripotency Associated 4 (DPPA4))

Autre désignation: DPPA4 (DPPA4 Produits)

Synonymes: anticorps 2410091M23Rik, anticorps C76608, anticorps ECAT15-1, anticorps DPPA4, anticorps Dppa4, anticorps developmental pluripotency associated 4, anticorps DppA4, anticorps peptide ABC transporter substrate-binding protein, anticorps dipeptide ABC transport system, substrate-binding protein, anticorps similar to developmental pluripotency associated 4 isoform 1, anticorps DPPA4, anticorps Dppa4, anticorps dppA4, anticorps HVO_RS14920, anticorps LOC100360556, anticorps LOC683300

Sujet: DPPA4 may play a role in maintaining cell pluripotentiality.

Poids moléculaire: 33 kDa (MW of target protein)