NCRNA00114 anticorps (N-Term)

N° du produit ABIN631869

Détail du produit anti-NCRNA00114 anticorps

Antigène: NCRNA00114 (Non-Protein Coding RNA 114 (NCRNA00114))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NCRNA00114 est non-conjugé

Application: Western Blotting (WB)

Specificité: NCRNA00114 antibody was raised against the N terminal Of Ncrna00114

Purification: Affinity purified

Immunogène: NCRNA00114 antibody was raised using the N terminal Of Ncrna00114 corresponding to a region with amino acids SFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NCRNA00114 Blocking Peptide, catalog no. 33R-8438, is also available for use as a blocking control in assays to test for specificity of this NCRNA00114 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCRNA00114 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NCRNA00114

Antigène: NCRNA00114 (Non-Protein Coding RNA 114 (NCRNA00114))

Autre désignation: NCRNA00114 (NCRNA00114 Produits)

Synonymes: anticorps C21orf24, anticorps NCRNA00114, anticorps long intergenic non-protein coding RNA 114, anticorps LINC00114

Sujet: The specific function of NCRNA00114 is not yet known.

Poids moléculaire: 15 kDa (MW of target protein)